Recombinant Human CRH protein, His-tagged
Cat.No. : | CRH-3467H |
Product Overview : | Recombinant Human CRH protein(53-156 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 53-156 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEE |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRH corticotropin releasing hormone [ Homo sapiens ] |
Official Symbol | CRH |
Synonyms | CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor; |
Gene ID | 1392 |
mRNA Refseq | NM_000756 |
Protein Refseq | NP_000747 |
MIM | 122560 |
UniProt ID | P06850 |
◆ Recombinant Proteins | ||
CRH-217H | Recombinant Human CRH protein, T7-tagged | +Inquiry |
CRH-3048H | Recombinant Human Corticotropin Releasing Hormone, T7-tagged | +Inquiry |
CRH-1806H | Recombinant Human CRH Protein (His40-Gly195), N-His tagged | +Inquiry |
CRH-183H | Recombinant Human CRH | +Inquiry |
CRH-1596R | Recombinant Rat CRH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRH-7281HCL | Recombinant Human CRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRH Products
Required fields are marked with *
My Review for All CRH Products
Required fields are marked with *
0
Inquiry Basket