Recombinant Human CRADD protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length :	1-199 aa
AA Sequence :	MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Purity :	95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution :	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Name	CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ]
Official Symbol	CRADD
Synonyms	CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163;
Gene ID	8738
mRNA Refseq	NM_003805
Protein Refseq	NP_003796
MIM	603454
UniProt ID	P78560