Recombinant Full Length Human CRABP2 Protein, GST-tagged

Cat.No. : CRABP2-2250HF
Product Overview : Human CRABP2 full-length ORF ( NP_001869.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 138 amino acids
Description : This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010]
Molecular Mass : 42.1 kDa
AA Sequence : MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRABP2 cellular retinoic acid binding protein 2 [ Homo sapiens ]
Official Symbol CRABP2
Synonyms CRABP2; cellular retinoic acid binding protein 2; cellular retinoic acid-binding protein 2; CRABP II; cellular retinoic acid-binding protein II; RBP6; CRABP-II
Gene ID 1382
mRNA Refseq NM_001199723
Protein Refseq NP_001186652
MIM 180231
UniProt ID P29373

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CRABP2 Products

Required fields are marked with *

My Review for All CRABP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon