Recombinant Full Length Human CRABP2 Protein, GST-tagged
Cat.No. : | CRABP2-2250HF |
Product Overview : | Human CRABP2 full-length ORF ( NP_001869.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 138 amino acids |
Description : | This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010] |
Molecular Mass : | 42.1 kDa |
AA Sequence : | MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRABP2 cellular retinoic acid binding protein 2 [ Homo sapiens ] |
Official Symbol | CRABP2 |
Synonyms | CRABP2; cellular retinoic acid binding protein 2; cellular retinoic acid-binding protein 2; CRABP II; cellular retinoic acid-binding protein II; RBP6; CRABP-II |
Gene ID | 1382 |
mRNA Refseq | NM_001199723 |
Protein Refseq | NP_001186652 |
MIM | 180231 |
UniProt ID | P29373 |
◆ Recombinant Proteins | ||
CRABP2-3086H | Recombinant Human CRABP2 protein, His-tagged | +Inquiry |
CRABP2-839R | Recombinant Rhesus Macaque CRABP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Crabp2-4039M | Recombinant Mouse Crabp2 protein(Pro2-Glu138), His-tagged | +Inquiry |
Crabp2-2302M | Recombinant Mouse Crabp2 Protein, Myc/DDK-tagged | +Inquiry |
CRABP2-2250HF | Recombinant Full Length Human CRABP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRABP2-7295HCL | Recombinant Human CRABP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRABP2 Products
Required fields are marked with *
My Review for All CRABP2 Products
Required fields are marked with *
0
Inquiry Basket