Recombinant Human CPT1A protein, His-tagged

• Cat.No.: CPT1A-1185H
• Product Overview: Recombinant Human CPT1A protein(NP_001027017.1)(Arg191~Leu353) was expressed in E. coli with a N-terminal His Tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Arg191~Leu353
• Description: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: Supplied as lyophilized form in PBS, pH7.4, containing 5% sucrose.
• Molecular Mass: The protein has a predicted molecular mass of 21.0kDa.
• AA Sequence: MGHHHHHHSGSEFRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRL
• Endotoxin: <1.0 EU per 1μg (determined by the LAL method).
• Purity: >95%, 23kDa as determined by SDS-PAGE reducing conditions.
• Applications: SDS-PAGE; WB; ELISA; IP.
  (May be suitable for use in other assays to be determined by the end user.)
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
• Reconstitution: Reconstitute in sterile PBS, pH7.2-pH7.4.

Gene Information

• Gene Name: CPT1A carnitine palmitoyltransferase 1A [Homo sapiens (human)]
• Official Symbol: CPT1A
• Synonyms: CPT1A, CPT1
• Gene ID: 1374
• mRNA Refseq: NM_001031847.3
• Protein Refseq: NP_001027017.1
• MIM: 600528
• UniProt ID: P50416