Recombinant Human CPS1, His-tagged
Cat.No. : | CPS1-1843H |
Product Overview : | Recombinant Human CPS1 protein (1361 - 1500 aa) was expressed in E. coli with His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1361-1500 a.a. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
Molecular Mass : | 21 kDa |
AA Sequence : | GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA |
Gene Name | CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ]+AV3:BI3 |
Official Symbol | CPS1 |
Synonyms | CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1; |
Gene ID | 1373 |
mRNA Refseq | NM_001122633 |
Protein Refseq | NP_001116105 |
UniProt ID | P31327 |
◆ Recombinant Proteins | ||
CPS1-1941M | Recombinant Mouse CPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPS1-0486H | Recombinant Human CPS1 protein, His-tagged | +Inquiry |
CPS1-1573R | Recombinant Rat CPS1 Protein | +Inquiry |
CPS1-1809H | Recombinant Human CPS1 Protein, GST-tagged | +Inquiry |
CPS1-3857M | Recombinant Mouse CPS1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPS1 Products
Required fields are marked with *
My Review for All CPS1 Products
Required fields are marked with *
0
Inquiry Basket