Recombinant Human CPS1, His-tagged

Cat.No. : CPS1-1843H
Product Overview : Recombinant Human CPS1 protein (1361 - 1500 aa) was expressed in E. coli with His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1361-1500 a.a.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
Molecular Mass : 21 kDa
AA Sequence : GILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Gene Name CPS1 carbamoyl-phosphate synthase 1, mitochondrial [ Homo sapiens ]+AV3:BI3
Official Symbol CPS1
Synonyms CPS1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl phosphate synthetase 1, mitochondrial; carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoylphosphate synthetase I; CPSASE1;
Gene ID 1373
mRNA Refseq NM_001122633
Protein Refseq NP_001116105
UniProt ID P31327

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CPS1 Products

Required fields are marked with *

My Review for All CPS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon