Recombinant Human CPLX1, His-tagged

• Cat.No.: CPLX1-27587TH
• Product Overview: Recombinant full length Human CPLX1 with N terminal His tag; 154 amino acids with a predicted MWt 17.1 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 134 amino acids
• Description: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis.These proteins bind syntaxin, part of the SNAP receptor.The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release.
• Conjugation: HIS
• Molecular Weight: 17.100kDa inclusive of tags
• Tissue specificity: Nervous system. In hippocampus and cerebellum, expressed mainly by inhibitory neurons. Overexpressed in substantia nigra from patients with Parkinson disease.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEFVMKQALGGATKDMGKML GGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE AVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
• Sequence Similarities: Belongs to the complexin/synaphin family.

Gene Information

• Gene Name: CPLX1 complexin 1 [ Homo sapiens ]
• Official Symbol: CPLX1
• Synonyms: CPLX1; complexin 1; complexin-1; CPX I
• Gene ID: 10815
• mRNA Refseq: NM_006651
• Protein Refseq: NP_006642
• MIM: 605032
• Uniprot ID: O14810
• Chromosome Location: 4p16.3
• Pathway: Acetylcholine Neurotransmitter Release Cycle, organism-specific biosystem; Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; GABA synthesis, release, reuptake and degradation, organism-specific biosystem; Glutamate Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem
• Function: neurotransmitter transporter activity; syntaxin-1 binding