Recombinant Human CPE protein(252-363aa), His-GST&Myc-tagged

• Cat.No.: CPE-4356H
• Product Overview: Recombinant Human CPE protein(P16870)(252-363aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His-GST&C-Myc
• Protein length: 252-363aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.7 kDa
• AASequence: LVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CPE carboxypeptidase E [ Homo sapiens ]
• Official Symbol: CPE
• Synonyms: CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase
• Gene ID: 1363
• mRNA Refseq: NM_001873
• Protein Refseq: NP_001864
• MIM: 114855
• UniProt ID: P16870