Description :	COX8C (Cytochrome C Oxidase Subunit 8C) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. GO annotations related to this gene include cytochrome-c oxidase activity.
Molecular Mass :	34.5 kDa
AA Sequence :	MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	COX8C cytochrome c oxidase subunit 8C [ Homo sapiens (human) ]
Official Symbol	COX8C
Synonyms	COX8C; cytochrome c oxidase subunit 8C; Cytochrome C Oxidase Subunit 8C; Cytochrome C Oxidase Subunit VIIIC; Cytochrome C Oxidase Subunit 8-3; COX VIII-3; COX8-3; Cytochrome C Oxidase Polypeptide VIII Isoform 3; Cytochrome C Oxidase Subunit 8C, Mitochondrial; Cytochrome C Oxidase Polypeptide 8 Isoform 3; Cytochrome C Oxidase Subunit VIII Isoform 3; Cytochrome C Oxidase Polypeptide VIII; Cytochrome C Oxidase Polypeptide 8; Cytochrome C Oxidase Subunit VIII; cytochrome c oxidase subunit 8C, mitochondrial; COX VIII-3; cytochrome c oxidase polypeptide 8; cytochrome c oxidase polypeptide VIII; cytochrome c oxidase subunit 8-3; cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIC
Gene ID	341947
mRNA Refseq	NM_182971
Protein Refseq	NP_892016
MIM	616855
UniProt ID	Q7Z4L0