Recombinant Human COX8A Protein, GST-tagged

• Cat.No.: COX8A-1765H
• Product Overview: Human COX8A full-length ORF ( NP_004065.1, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34 kDa
• AA Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX8A cytochrome c oxidase subunit 8A [ Homo sapiens (human) ]
• Official Symbol: COX8A
• Synonyms: COX8A; cytochrome c oxidase subunit 8A; Cytochrome C Oxidase Subunit 8A; Cytochrome C Oxidase Polypeptide VIII-Liver/Heart; Cytochrome C Oxidase Subunit VIIIA (Ubiquitous); Cytochrome C Oxidase Subunit VIII; Cytochrome C Oxidase Subunit 8-2; COX8L; COX8; Cytochrome C Oxidase Subunit 8A, Mitochondrial; Cytochrome C Oxidase Subunit 8A (Ubiquitous); COX8-2; VIII-L; VIII; COX; cytochrome c oxidase subunit 8A, mitochondrial; cytochrome c oxidase polypeptide VIII-liver/heart; cytochrome c oxidase subunit 8-2; cytochrome c oxidase subunit 8A (ubiquitous); cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIA (ubiquitous); EC 1.9.3.1
• Gene ID: 1351
• mRNA Refseq: NM_004074
• Protein Refseq: NP_004065
• MIM: 123870
• UniProt ID: P10176