Recombinant Human COX7B Protein, GST-tagged
Cat.No. : | COX7B-1763H |
Product Overview : | Human COX7B full-length ORF ( AAH18386, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX7B cytochrome c oxidase subunit VIIb [ Homo sapiens ] |
Official Symbol | COX7B |
Synonyms | COX7B; cytochrome c oxidase subunit VIIb; cytochrome c oxidase subunit 7B, mitochondrial; cytochrome-c oxidase chain VIIb; cytochrome c oxidase polypeptide VIIb; |
Gene ID | 1349 |
mRNA Refseq | NM_001866 |
Protein Refseq | NP_001857 |
MIM | 603792 |
UniProt ID | P24311 |
◆ Recombinant Proteins | ||
COX7B-119H | Recombinant Human COX7B Protein, His-tagged | +Inquiry |
COX7B-7085Z | Recombinant Zebrafish COX7B | +Inquiry |
COX7B-1763H | Recombinant Human COX7B Protein, GST-tagged | +Inquiry |
COX7B-1921M | Recombinant Mouse COX7B Protein, His (Fc)-Avi-tagged | +Inquiry |
COX7B-822R | Recombinant Rhesus Macaque COX7B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX7B Products
Required fields are marked with *
My Review for All COX7B Products
Required fields are marked with *
0
Inquiry Basket