Recombinant Human COX7A2L protein, His-tagged

• Cat.No.: COX7A2L-11501H
• Product Overview: Recombinant Human COX7A2L protein(1-114 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-114 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: COX7A2L cytochrome c oxidase subunit VIIa polypeptide 2 like [ Homo sapiens ]
• Official Symbol: COX7A2L
• Synonyms: COX7A2L; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7AR; COX7RP; EB1; SIG81; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein
• mRNA Refseq: NM_004718
• Protein Refseq: NP_004709
• MIM: 605771
• UniProt ID: O14548
• Gene ID: 9167