Recombinant Human COX6C Protein, GST-tagged

• Cat.No.: COX6C-1758H
• Product Overview: Human COX6C full-length ORF ( AAH00187, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12. [provided by RefSeq, Jul 2010]
• Molecular Mass: 33.99 kDa
• AA Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX6C cytochrome c oxidase subunit VIc [ Homo sapiens ]
• Official Symbol: COX6C
• Synonyms: COX6C; cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein
• Gene ID: 1345
• mRNA Refseq: NM_004374
• Protein Refseq: NP_004365
• MIM: 124090
• UniProt ID: P09669