Recombinant Human COX6B2 Protein, GST-tagged

• Cat.No.: COX6B2-1756H
• Product Overview: Human COX6B2 full-length ORF ( NP_653214.2, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COX6B2 (Cytochrome C Oxidase Subunit 6B2) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. GO annotations related to this gene include cytochrome-c oxidase activity. An important paralog of this gene is COX6B1.
• Molecular Mass: 36.9 kDa
• AA Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX6B2 cytochrome c oxidase subunit VIb polypeptide 2 (testis) [ Homo sapiens ]
• Official Symbol: COX6B2
• Synonyms: COX6B2; cytochrome c oxidase subunit VIb polypeptide 2 (testis); cytochrome c oxidase subunit 6B2; cancer/testis antigen 59; COXVIB2; CT59; cytochrome c oxidase subunit VIb; testes specific; FLJ32865; COX VIb-2; cytochrome c oxidase subunit VIb, testes specific; cytochrome c oxidase subunit VIb, testes-specific; cytochrome c oxidase subunit VIb, testis-specific isoform; FLJ46422; MGC119094
• Gene ID: 125965
• mRNA Refseq: NM_144613
• Protein Refseq: NP_653214
• UniProt ID: Q6YFQ2