Recombinant Human COX6A1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COX6A1-5841H
• Product Overview: COX6A1 MS Standard C13 and N15-labeled recombinant protein (NP_004364) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.
• Molecular Mass: 12.2 kDa
• AA Sequence: MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens (human) ]
• Official Symbol: COX6A1
• Synonyms: COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial; COX VIa-L; cytochrome c oxidase subunit VIA-liver; cytochrome C oxidase subunit VIa homolog; cytochrome c oxidase polypeptide VIa-liver; COX6AL; MGC104500
• Gene ID: 1337
• mRNA Refseq: NM_004373
• Protein Refseq: NP_004364
• MIM: 602072
• UniProt ID: P12074