Recombinant Human COX5B Protein, GST-tagged

• Cat.No.: COX5B-1751H
• Product Overview: Human COX5B full-length ORF ( AAH06229.1, 1 a.a. - 129 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.82 kDa
• AA Sequence: MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX5B cytochrome c oxidase subunit Vb [ Homo sapiens ]
• Official Symbol: COX5B
• Synonyms: COX5B; cytochrome c oxidase subunit Vb; cytochrome c oxidase subunit 5B, mitochondrial; cytochrome c oxidase polypeptide VB, mitochondrial; COXVB
• Gene ID: 1329
• mRNA Refseq: NM_001862
• Protein Refseq: NP_001853
• MIM: 123866
• UniProt ID: P10606