Recombinant Human CORO2A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CORO2A-3330H |
Product Overview : | CORO2A MS Standard C13 and N15-labeled recombinant protein (NP_003380) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 5 WD repeats, and has a structural similarity with actin-binding proteins: the D. discoideum coronin and the human p57 protein, suggesting that this protein may also be an actin-binding protein that regulates cell motility. Alternative splicing of this gene generates 2 transcript variants. |
Molecular Mass : | 59.8 kDa |
AA Sequence : | MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CORO2A coronin 2A [ Homo sapiens (human) ] |
Official Symbol | CORO2A |
Synonyms | CORO2A; coronin, actin binding protein, 2A; coronin-2A; coronin 2A; coronin like protein B; IR10; WD protein IR10; WD repeat protein 2; WDR2; WD-repeat protein 2; coronin-like protein B; WD repeat-containing protein 2; coronin, actin-binding protein, 2A; CLIPINB; DKFZp686G19226; |
Gene ID | 7464 |
mRNA Refseq | NM_003389 |
Protein Refseq | NP_003380 |
MIM | 602159 |
UniProt ID | Q92828 |
◆ Recombinant Proteins | ||
CORO2A-10044Z | Recombinant Zebrafish CORO2A | +Inquiry |
CORO2A-1727H | Recombinant Human CORO2A Protein, GST-tagged | +Inquiry |
CORO2A-2719H | Recombinant Human CORO2A Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO2A-3330H | Recombinant Human CORO2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CORO2A-579H | Recombinant Human CORO2A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
CORO2A-7341HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORO2A Products
Required fields are marked with *
My Review for All CORO2A Products
Required fields are marked with *
0
Inquiry Basket