Recombinant Human CORO1C Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CORO1C-2044H |
Product Overview : | CORO1C MS Standard C13 and N15-labeled recombinant protein (NP_055140) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Three transcript variants encoding two different isoforms have been found for this gene. |
Molecular Mass : | 53.2 kDa |
AA Sequence : | MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CORO1C coronin 1C [ Homo sapiens (human) ] |
Official Symbol | CORO1C |
Synonyms | CORO1C; coronin, actin binding protein, 1C; coronin-1C; coronin 3; HCRNN4; coronin-3; coronin 1C; coronin, actin-binding protein, 1C; |
Gene ID | 23603 |
mRNA Refseq | NM_014325 |
Protein Refseq | NP_055140 |
MIM | 605269 |
UniProt ID | Q9ULV4 |
◆ Recombinant Proteins | ||
CORO1C-5213C | Recombinant Chicken CORO1C | +Inquiry |
CORO1C-803R | Recombinant Rhesus Macaque CORO1C Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO1C-1986HF | Recombinant Full Length Human CORO1C Protein, GST-tagged | +Inquiry |
CORO1C-646H | Recombinant Human CORO1C Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO1C-978R | Recombinant Rhesus monkey CORO1C Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO1C-7343HCL | Recombinant Human CORO1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORO1C Products
Required fields are marked with *
My Review for All CORO1C Products
Required fields are marked with *
0
Inquiry Basket