Recombinant Human CORIN Protein, GST-tagged

• Cat.No.: CORIN-1722H
• Product Overview: Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]
• Molecular Mass: 36.74 kDa
• AA Sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CORIN corin, serine peptidase [ Homo sapiens ]
• Official Symbol: CORIN
• Synonyms: CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742
• Gene ID: 10699
• mRNA Refseq: NM_006587
• Protein Refseq: NP_006578
• MIM: 605236
• UniProt ID: Q9Y5Q5