Recombinant Human CORIN Protein, GST-tagged
Cat.No. : | CORIN-1722H |
Product Overview : | Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CORIN corin, serine peptidase [ Homo sapiens ] |
Official Symbol | CORIN |
Synonyms | CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742; |
Gene ID | 10699 |
mRNA Refseq | NM_006587 |
Protein Refseq | NP_006578 |
MIM | 605236 |
UniProt ID | Q9Y5Q5 |
◆ Recombinant Proteins | ||
CORIN-1702H | Recombinant Human CORIN Protein (Gly70-Thr136), N-GST tagged | +Inquiry |
Corin-444R | Recombinant Rat Corin Protein, His-tagged | +Inquiry |
Corin-2271M | Recombinant Mouse Corin Protein, Myc/DDK-tagged | +Inquiry |
CORIN-3796M | Recombinant Mouse CORIN Protein | +Inquiry |
CORIN-1902M | Recombinant Mouse CORIN Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CORIN Products
Required fields are marked with *
My Review for All CORIN Products
Required fields are marked with *
0
Inquiry Basket