Recombinant Human COQ4 Protein, GST-tagged

• Cat.No.: COQ4-1717H
• Product Overview: Human COQ4 full-length ORF ( AAH11895.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a component of the coenzyme Q biosynthesis pathway. Coenzyme Q, an essential component of the electron transport chain, shuttles electrons between complexes I or II to complex III of the mitochondrial transport chain. This protein appears to play a structural role in stabilizing a complex that contains most of the coenzyme Q biosynthesis enzymes. Mutations in this gene are associated with mitochondrial disorders linked to coenzyme Q deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.1 kDa
• AA Sequence: MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COQ4 coenzyme Q4 [ Homo sapiens (human) ]
• Official Symbol: COQ4
• Synonyms: COQ4; coenzyme Q4; Coenzyme Q4; Coenzyme Q Biosynthesis Protein 4 Homolog; Ubiquinone Biosynthesis Protein COQ4 Homolog, Mitochondrial; Coenzyme Q4 Homolog (S. Cerevisiae); Coenzyme Q4 Homolog (Yeast); Coenzyme Q4 Homolog; COQ10D7; CGI-92; ubiquinone biosynthesis protein COQ4 homolog, mitochondrial; coenzyme Q biosynthesis protein 4 homolog; coenzyme Q4 homolog
• Gene ID: 51117
• mRNA Refseq: NM_001305942
• Protein Refseq: NP_001292871
• MIM: 612898
• UniProt ID: Q9Y3A0