Recombinant Human COPS7A Protein, GST-tagged

• Cat.No.: COPS7A-1708H
• Product Overview: Human COPS7A full-length ORF ( NP_057403.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Mar 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.7 kDa
• AA Sequence: MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COPS7A COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis) [ Homo sapiens ]
• Official Symbol: COPS7A
• Synonyms: COP9 signalosome complex subunit 7a; CSN7A; Dermal papilla derived protein 10; DERP10; JAB1 containing signalosome subunit 7a; SGN7a; Signalosome subunit 7a; COP9 signalosome complex subunit 7a; SGN7a; signalosome subunit 7a; COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A
• Gene ID: 50813
• mRNA Refseq: NM_016319.2
• Protein Refseq: NP_057403.1
• MIM: 616009
• UniProt ID: Q9UBW8