Recombinant Human COPS7A Protein, GST-tagged

Cat.No. : COPS7A-1708H
Product Overview : Human COPS7A full-length ORF ( NP_057403.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a component of the COP9 signalosome, an evolutionarily conserved multi-subunit protease that regulates the activity of the ubiquitin conjugation pathway. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Mar 2014]
Molecular Mass : 56.7 kDa
AA Sequence : MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COPS7A COP9 constitutive photomorphogenic homolog subunit 7A (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS7A
Synonyms COP9 signalosome complex subunit 7a; CSN7A; Dermal papilla derived protein 10; DERP10; JAB1 containing signalosome subunit 7a; SGN7a; Signalosome subunit 7a; COP9 signalosome complex subunit 7a; SGN7a; signalosome subunit 7a; COP9 complex subunit 7a; COP9 constitutive photomorphogenic homolog subunit 7A
Gene ID 50813
mRNA Refseq NM_016319.2
Protein Refseq NP_057403.1
MIM 616009
UniProt ID Q9UBW8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COPS7A Products

Required fields are marked with *

My Review for All COPS7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon