Recombinant Human COMMD9 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COMMD9-2711H
• Product Overview: COMMD9 MS Standard C13 and N15-labeled recombinant protein (NP_054905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes. May down-regulate activation of NF-kappa-B. Modulates Na+ transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.8 kDa
• AA Sequence: MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COMMD9 COMM domain containing 9 [ Homo sapiens (human) ]
• Official Symbol: COMMD9
• Synonyms: COMMD9; COMM domain containing 9; HSPC166; C11orf55; LINC00610; COMM domain-containing protein 9
• Gene ID: 29099
• mRNA Refseq: NM_014186
• Protein Refseq: NP_054905
• MIM: 612299
• UniProt ID: Q9P000