Recombinant Human COMMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMMD8-3951H |
Product Overview : | COMMD8 MS Standard C13 and N15-labeled recombinant protein (NP_060315) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMMD8 COMM domain containing 8 [ Homo sapiens (human) ] |
Official Symbol | COMMD8 |
Synonyms | COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502; |
Gene ID | 54951 |
mRNA Refseq | NM_017845 |
Protein Refseq | NP_060315 |
MIM | 616656 |
UniProt ID | Q9NX08 |
◆ Recombinant Proteins | ||
COMMD8-11450H | Recombinant Human COMMD8, GST-tagged | +Inquiry |
COMMD8-5173C | Recombinant Chicken COMMD8 | +Inquiry |
COMMD8-360H | Recombinant Human COMMD8 protein(Met1-Lys183), His-tagged | +Inquiry |
COMMD8-3951H | Recombinant Human COMMD8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Commd8-2253M | Recombinant Mouse Commd8 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD8-7367HCL | Recombinant Human COMMD8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD8 Products
Required fields are marked with *
My Review for All COMMD8 Products
Required fields are marked with *
0
Inquiry Basket