Recombinant Human COMMD8 Protein, GST-tagged

• Cat.No.: COMMD8-1685H
• Product Overview: Human COMMD8 full-length ORF ( NP_060315.1, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene binds coiled-coil domain-containing protein 22 (CCDC22), and this complex can regulate the turnover of I-kappa-B and the activation of NF-kappa-B. [provided by RefSeq, Jul 2016]
• Molecular Mass: 47.5 kDa
• AA Sequence: MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD8 COMM domain containing 8 [ Homo sapiens ]
• Official Symbol: COMMD8
• Synonyms: COMMD8; COMM domain containing 8; COMM domain-containing protein 8; FLJ20502
• Gene ID: 54951
• mRNA Refseq: NM_017845
• Protein Refseq: NP_060315
• MIM: 616656
• UniProt ID: Q9NX08