Recombinant Human COMMD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COMMD4-1206H
• Product Overview: COMMD4 MS Standard C13 and N15-labeled recombinant protein (NP_060298) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: COMMD4 (COMM Domain Containing 4) is a Protein Coding gene.
• Molecular Mass: 21.6 kDa
• AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COMMD4 COMM domain containing 4 [ Homo sapiens (human) ]
• Official Symbol: COMMD4
• Synonyms: COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452
• Gene ID: 54939
• mRNA Refseq: NM_017828
• Protein Refseq: NP_060298
• MIM: 616701
• UniProt ID: Q9H0A8