Recombinant Full Length Human COMMD4 Protein, GST-tagged

• Cat.No.: COMMD4-1942HF
• Product Overview: Human COMMD4 full-length ORF ( NP_060298.2, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: COMMD4 (COMM Domain Containing 4) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.2 kDa
• Protein length: 199 amino acids
• AA Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD4 COMM domain containing 4 [ Homo sapiens ]
• Official Symbol: COMMD4
• Synonyms: COMMD4; COMM domain containing 4; COMM domain-containing protein 4; FLJ20452
• Gene ID: 54939
• mRNA Refseq: NM_017828
• Protein Refseq: NP_060298
• MIM: 616701
• UniProt ID: Q9H0A8