Recombinant Human COMMD3, His-tagged
Cat.No. : | COMMD3-28015TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-183 of Human COMMD3 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 1-183 a.a. |
Description : | COMMD3 is widely expressed, with highest expression in thymus. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 94 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQ ADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRA DKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQ NTDSPSYPEISFSCSMEQLQDLVGKLK |
Gene Name | COMMD3 COMM domain containing 3 [ Homo sapiens ] |
Official Symbol | COMMD3 |
Synonyms | COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; |
Gene ID | 23412 |
mRNA Refseq | NM_012071 |
Protein Refseq | NP_036203 |
Uniprot ID | Q9UBI1 |
Chromosome Location | 10pter-q22.1 |
Function | protein binding; |
◆ Native Proteins | ||
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
LANCL1-4826HCL | Recombinant Human LANCL1 293 Cell Lysate | +Inquiry |
C5orf49-121HCL | Recombinant Human C5orf49 lysate | +Inquiry |
MIS18BP1-202HCL | Recombinant Human MIS18BP1 cell lysate | +Inquiry |
TOE1-874HCL | Recombinant Human TOE1 293 Cell Lysate | +Inquiry |
Testis-516H | Human Testis Membrane Tumor Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD3 Products
Required fields are marked with *
My Review for All COMMD3 Products
Required fields are marked with *
0
Inquiry Basket