Recombinant Human COMMD10 Protein, GST-tagged

• Cat.No.: COMMD10-1676H
• Product Overview: Human COMMD10 full-length ORF ( NP_057228.1, 1 a.a. - 202 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: COMMD10 (COMM Domain Containing 10) is a Protein Coding gene.
• Molecular Mass: 49.4 kDa
• AA Sequence: MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD10 COMM domain containing 10 [ Homo sapiens ]
• Official Symbol: COMMD10
• Synonyms: COMMD10; COMM domain containing 10; COMM domain-containing protein 10; PTD002; FLJ11285
• Gene ID: 51397
• mRNA Refseq: NM_016144
• Protein Refseq: NP_057228
• MIM: 616704
• UniProt ID: Q9Y6G5