Recombinant Human COLQ Protein, GST-tagged
Cat.No. : | COLQ-1672H |
Product Overview : | Human COLQ full-length ORF (BAG54671.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in this gene are associated with endplate acetylcholinesterase deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 72.9 kDa |
AA Sequence : | MTGSSFSLAHLLIISGLLCYSAGCLALPSLDQKKRGGHKACCLLTPPPPPLFPPPFFRGGRSPLLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQGPPGLPGKTGPKGEKGELGRPGRKGRPGPPGVPGMPGPIGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGYPGSRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEPGIAGHRGPTGRPGKRGKQGQKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGERGFPGPPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCHRAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COLQ collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase [ Homo sapiens ] |
Official Symbol | COLQ |
Synonyms | COLQ; collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase; acetylcholinesterase collagenic tail peptide; acetylcholinesterase associated collagen; AChE Q subunit; collagenic tail of endplate acetylcholinesterase; EAD; single strand of homotrimeric collagen like tail subunit of asymmetric acetylcholinesterase; acetylcholinesterase-associated collagen; single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase; FLJ55041; |
Gene ID | 8292 |
mRNA Refseq | NM_005677 |
Protein Refseq | NP_005668 |
MIM | 603033 |
UniProt ID | Q9Y215 |
◆ Recombinant Proteins | ||
COLQ-2212HF | Recombinant Full Length Human COLQ Protein, GST-tagged | +Inquiry |
Colq-3061R | Recombinant Rat Colq, His-tagged | +Inquiry |
COLQ-1875M | Recombinant Mouse COLQ Protein, His (Fc)-Avi-tagged | +Inquiry |
COLQ-1525R | Recombinant Rat COLQ Protein | +Inquiry |
COLQ-1182R | Recombinant Rat COLQ Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COLQ Products
Required fields are marked with *
My Review for All COLQ Products
Required fields are marked with *
0
Inquiry Basket