Recombinant Human COL6A2 protein, T7/His-tagged

• Cat.No.: COL6A2-28H
• Product Overview: Recombinant human Collagen VI extracellular domain cDNA (27 - 227 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 27-227 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGETELSVAQCTQRPVDIVFLLDGSERLGEQNFHKARRFVEQVARRLTLA RRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTAIHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGRARRHAE LSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR WIC
• Purity: ≥90% (SDS-PAGE)
• Applications: 1. May be used for in vitro various collagen VI / integrin binding regulation for cell lineage specific differentiations study coating with this protein.2. May be used for protein-protein interaction assay.3. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: COL6A2 collagen, type VI, alpha 2 [ Homo sapiens ]
• Official Symbol: COL6A2
• Synonyms: COL6A2; collagen, type VI, alpha 2; collagen alpha-2(VI) chain; collagen VI, alpha-2 polypeptide; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; FLJ46862; DKFZp586E1322
• Gene ID: 1292
• mRNA Refseq: NM_001849
• Protein Refseq: NP_001840
• MIM: 120240
• UniProt ID: P12110
• Chromosome Location: 21q22.3
• Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: extracellular matrix structural constituent; protein binding; protein binding, bridging