Recombinant Full Length Human COL6A2 Protein, C-Flag-tagged
Cat.No. : | COL6A2-1544HFL |
Product Overview : | Recombinant Full Length Human COL6A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The product of this gene contains several domains similar to von Willebrand Factor type A domains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in this gene are associated with Bethlem myopathy and Ullrich scleroatonic muscular dystrophy. Three transcript variants have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 95.3 kDa |
AA Sequence : | MLQGTCSVLLLWGILGAIQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHM KQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALAN MTEQIRQDRSKGTVHFAVVITDGHVTGSPCGGIKLQAERAREEGIRLFAVAPNQNLKEQGLRDIASTPHE LYRNDYATMLPDSTEINQDTINRIIKVMKHEAYGECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPG QKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGN RGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNNGAPGSPGVKGAKGGPGPRGPK GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLPGPRGPQGALGEPGKQGSRG DPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRGDFGLKGEPGRKGEKGEPADP GPPGEPGPRGPRGVPGPEGEPGPPGDPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTN FTLEKNFVINVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIQLDDEHIDSLSSFKEAVKNLEWIAGG TWTPSALKFAYDRLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESE NLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTDAPWPGGEPPVTFLRTEEGP DATFPRTIPLIQQLLNATELTQDPAAYSQLVAVLVYTAERAKFATGVERQDWMELFIDTFKLVHRDIVGD PETALALCSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Protein Pathways : | ECM-receptor interaction, Focal adhesion |
Full Length : | Full L. |
Gene Name | COL6A2 collagen type VI alpha 2 chain [ Homo sapiens (human) ] |
Official Symbol | COL6A2 |
Synonyms | UCMD1; BTHLM1; PP3610 |
Gene ID | 1292 |
mRNA Refseq | NM_058174.3 |
Protein Refseq | NP_478054.2 |
MIM | 120240 |
UniProt ID | P12110 |
◆ Recombinant Proteins | ||
AKT336891H | Recombinant Human PKB gamma - AKT3 (1-479) Protein | +Inquiry |
VGLL2B-3381Z | Recombinant Zebrafish VGLL2B | +Inquiry |
HGF-4235H | Recombinant Human HGF Protein (Gln31-Ser723), C-His tagged | +Inquiry |
TLR5-989H | Recombinant Human TLR5 protein, GST-tagged | +Inquiry |
HSP90AA1-269H | Recombinant Human HSP90AA1 protein, His/MBP-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-31M | Native Mouse Carbonic Anhydrase II (CA2) Protein | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS3A-564HCL | Recombinant Human RPS3A lysate | +Inquiry |
PIK3AP1-3192HCL | Recombinant Human PIK3AP1 293 Cell Lysate | +Inquiry |
SPC24-1528HCL | Recombinant Human SPC24 293 Cell Lysate | +Inquiry |
FCGR2A-1926CCL | Recombinant Cynomolgus FCGR2A cell lysate | +Inquiry |
ABR-9122HCL | Recombinant Human ABR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL6A2 Products
Required fields are marked with *
My Review for All COL6A2 Products
Required fields are marked with *
0
Inquiry Basket