Recombinant Human COL6A1 Protein, GST-tagged

• Cat.No.: COL6A1-1659H
• Product Overview: Human COL6A1 partial ORF ( AAH52575, 919 a.a. - 1028 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: ALGYVTRFYREASSGAAKKRLLLFSDGNSQGATPAAIEKAVQEAQRAGIEIFVVVVGRQVNEPHIRVLVTGKTAEYDVAYGESHLFRVPSYQALLRGVFHQTVSRKVALG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL6A1 collagen, type VI, alpha 1 [ Homo sapiens ]
• Official Symbol: COL6A1
• Synonyms: COL6A1; collagen, type VI, alpha 1; collagen alpha-1(VI) chain; alpha 1 (VI) chain (61 AA); collagen VI, alpha-1 polypeptide; OPLL
• Gene ID: 1291
• mRNA Refseq: NM_001848
• Protein Refseq: NP_001839
• MIM: 120220
• UniProt ID: P12109