Name: Recombinant Human COL5A3 Protein, GST-tagged
SKU: COL5A3-1658H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This gene encodes an alpha chain for one of the low abundance fibrillar collagens. Fibrillar collagen molecules are trimers that can be composed of one or more types of alpha chains. Type V collagen is found in tissues containing type I collagen and appears to regulate the assembly of heterotypic fibers composed of both type I and type V collagen. This gene product is closely related to type XI collagen and it is possible that the collagen chains of types V and XI constitute a single collagen type with tissue-specific chain combinations. Mutations in this gene are thought to be responsible for the symptoms of a subset of patients with Ehlers-Danlos syndrome type III. Messages of several sizes can be detected in northern blots but sequence information cannot confirm the identity of the shorter messages. [provided by RefSeq, Jul 2008]
Molecular Mass :	35.42 kDa
AA Sequence :	EMVTLVADCEAQPPVLGHGPRFISIAGLTVLGTQDLGEKTFEGDIQELLISPDPQAAFQACERYLPDCDNLAPAATVAPQGEPETPRP
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	COL5A3 collagen, type V, alpha 3 [ Homo sapiens ]
Official Symbol	COL5A3
Synonyms	COL5A3; collagen, type V, alpha 3; collagen alpha-3(V) chain; pro-(alpha)3(V) collagen;
Gene ID	50509
mRNA Refseq	NM_015719
Protein Refseq	NP_056534
MIM	120216
UniProt ID	P25940