Recombinant Human COL4A3 protein, His-tagged

• Cat.No.: COL4A3-2715H
• Product Overview: Recombinant Human COL4A3 protein(Q01955)(1427-1668aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.6 kDa
• Protein length: 1427-1668aa
• AA Sequence: GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: COL4A3 collagen, type IV, alpha 3 (Goodpasture antigen) [ Homo sapiens ]
• Official Symbol: COL4A3
• Synonyms: COL4A3; collagen, type IV, alpha 3 (Goodpasture antigen); collagen alpha-3(IV) chain; tumstatin; collagen IV, alpha-3 polypeptide
• Gene ID: 1285
• mRNA Refseq: NM_000091
• Protein Refseq: NP_000082
• MIM: 120070
• UniProt ID: Q01955