Recombinant Human COL24A1 Protein, GST-tagged

• Cat.No.: COL24A1-1643H
• Product Overview: Human COL24A1 partial ORF ( NP_690850, 1626 a.a. - 1714 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the collagen gene family and is thought to regulate type I collagen fibrillogenesis during fetal development. [provided by RefSeq, Mar 2017]
• Molecular Mass: 35.53 kDa
• AA Sequence: PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL24A1 collagen, type XXIV, alpha 1 [ Homo sapiens ]
• Official Symbol: COL24A1
• Synonyms: COL24A1; collagen, type XXIV, alpha 1; collagen alpha-1(XXIV) chain; MGC142214
• Gene ID: 255631
• mRNA Refseq: NM_152890
• Protein Refseq: NP_690850
• MIM: 610025
• UniProt ID: Q17RW2