Recombinant Human COL19A1 Protein, GST-tagged

• Cat.No.: COL19A1-1639H
• Product Overview: Human COL19A1 partial ORF ( NP_001849, 27 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.42 kDa
• AA Sequence: RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COL19A1 collagen type XIX alpha 1 chain [ Homo sapiens (human) ]
• Official Symbol: COL19A1
• Synonyms: COL19A1; collagen type XIX alpha 1 chain; Collagen Type XIX Alpha 1 Chain; Collagen, Type XIX, Alpha 1; Collagen XIX, Alpha-1 Polypeptide; A1 Chain Of Type XIX Collagen; Collagen Alpha-1(XIX) Chain; Collagen Alpha 1 (Y) Chain; Collagen Alpha-1(Y) Chain; COL9A1L; D6S228E; collagen alpha-1(XIX) chain; a1 chain of type XIX collagen collagen XIX, alpha-1 polypeptide; collagen alpha 1 (Y) chain; collagen, type XIX, alpha 1
• Gene ID: 1310
• mRNA Refseq: NM_001858
• Protein Refseq: NP_001849
• MIM: 120165
• UniProt ID: Q14993