Recombinant Human COL11A1 protein, His-GST-tagged

• Cat.No.: COL11A1-4253H
• Product Overview: Recombinant Human COL11A1 protein(P12107)(532-699aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His-GST
• ProteinLength: 532-699aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.3 kDa
• AASequence: GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: COL11A1 collagen, type XI, alpha 1 [ Homo sapiens ]
• Official Symbol: COL11A1
• Synonyms: COL11A1; collagen, type XI, alpha 1; COLL6; collagen alpha-1(XI) chain; CO11A1; collagen XI; alpha 1 polypeptide; STL2; collagen XI, alpha-1 polypeptide
• Gene ID: 1301
• mRNA Refseq: NM_001190709
• Protein Refseq: NP_001177638
• MIM: 120280
• UniProt ID: P12107