Recombinant Human COIL

Cat.No. : COIL-26172TH
Product Overview : Recombinant fragment of Human Coilin with a proprietary tag: predicted molecular weight 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Description : The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14.
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Found in all the cell types examined.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP
Sequence Similarities : Belongs to the coilin family.
Gene Name COIL coilin [ Homo sapiens ]
Official Symbol COIL
Synonyms COIL; coilin; CLN80; p80 coilin;
Gene ID 8161
mRNA Refseq NM_004645
Protein Refseq NP_004636
MIM 600272
Uniprot ID P38432
Chromosome Location 17q22-q23
Function disulfide oxidoreductase activity; identical protein binding; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COIL Products

Required fields are marked with *

My Review for All COIL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon