Recombinant Human COA5 Protein, GST-tagged

• Cat.No.: COA5-1614H
• Product Overview: Human COA5 full-length ORF ( ADR82642.1, 1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011]
• Molecular Mass: 8.2 kDa
• AA Sequence: MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRGRKGY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COA5 cytochrome c oxidase assembly factor 5 [ Homo sapiens (human) ]
• Official Symbol: COA5
• Synonyms: COA5; cytochrome c oxidase assembly factor 5; Cytochrome C Oxidase Assembly Factor 5; C2orf64; Chromosome 2 Open Reading Frame 64; Protein C2orf64; 6330578E17Rik; CEMCOX3; Pet191; Pet191; C2orf64; CEMCOX3; 6330578E17Rik; cytochrome c oxidase assembly factor 5; protein C2orf64
• Gene ID: 493753
• mRNA Refseq: NM_001008215
• Protein Refseq: NP_001008216
• MIM: 613920
• UniProt ID: Q86WW8