Recombinant Human CNTNAP5 Protein, GST-tagged
Cat.No. : | CNTNAP5-1613H |
Product Overview : | Human CNTNAP5 partial ORF ( NP_570129, 1062 a.a. - 1160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DFVVVLLCKNGSLQVRYHLNKEETHVFTIDADNFANRRMHHLKINREGRELTIQMDQQLRLSYNFSPEVEFRVIRSLTLGKVTENLGLDSEVAKANAMG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNTNAP5 contactin associated protein like 5 [ Homo sapiens (human) ] |
Official Symbol | CNTNAP5 |
Synonyms | CNTNAP5; contactin associated protein like 5; Contactin Associated Protein Like 5; Cell Recognition Molecule Caspr5; Caspr5; Contactin Associated Protein-Like 5; Contactin-Associated Protein-Like 5; caspr5; contactin-associated protein-like 5; cell recognition molecule Caspr5 |
Gene ID | 129684 |
mRNA Refseq | NM_130773 |
Protein Refseq | NP_570129 |
MIM | 610519 |
UniProt ID | Q8WYK1 |
◆ Recombinant Proteins | ||
CNTNAP5-1613H | Recombinant Human CNTNAP5 Protein, GST-tagged | +Inquiry |
CNTNAP5-4938H | Recombinant Human CNTNAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNTNAP5-1058H | Recombinant Human CNTNAP5 protein, His & T7-tagged | +Inquiry |
CNTNAP5-3286H | Recombinant Human CNTNAP5 Protein, MYC/DDK-tagged | +Inquiry |
CNTNAP5-3507C | Recombinant Chicken CNTNAP5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNTNAP5 Products
Required fields are marked with *
My Review for All CNTNAP5 Products
Required fields are marked with *
0
Inquiry Basket