Recombinant Human CNTNAP3 protein, His-tagged

• Cat.No.: CNTNAP3-3935H
• Product Overview: Recombinant Human CNTNAP3 protein(625 - 695 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 625 - 695 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CNTNAP3 contactin associated protein-like 3 [ Homo sapiens ]
• Official Symbol: CNTNAP3
• Synonyms: CNTNAP3; contactin associated protein-like 3; contactin-associated protein-like 3; CASPR3; cell recognition molecule CASPR3 (FLJ14195; KIAA1714); CNTNAP3A; FLJ14195; KIAA1714; cell recognition molecule Caspr3; RP11-290L7.1; RP11-138L21.1
• Gene ID: 79937
• mRNA Refseq: NM_033655
• Protein Refseq: NP_387504
• MIM: 610517
• UniProt ID: Q9BZ76