Recombinant Human CNTLN Protein, GST-tagged

• Cat.No.: CNTLN-5166H
• Product Overview: Human C9orf39 partial ORF ( NP_060208, 971 a.a. - 1070 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CNTLN (Centlein) is a Protein Coding gene. Diseases associated with CNTLN include Seckel Syndrome 1 and Meesmann Corneal Dystrophy. GO annotations related to this gene include protein kinase binding and protein binding, bridging.
• Molecular Mass: 36.74 kDa
• AA Sequence: QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNTLN centlein [ Homo sapiens (human) ]
• Official Symbol: CNTLN
• Synonyms: CNTLN; centlein; C9orf39; C9orf101; bA340N12.1; centlein; centlein, centrosomal protein; centrosomal protein
• Gene ID: 54875
• mRNA Refseq: NM_001114395
• Protein Refseq: NP_001107867
• MIM: 611870
• UniProt ID: Q9NXG0