Recombinant Human CNTF Protein

• Cat.No.: CNTF-148H
• Product Overview: Recombinant Human Ciliary Neurotrophic Factor is produced by our E.coli expression system and the target gene encoding Ala2-Met200 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Ala2-Met200
• Description: Ciliary Neurotrophic Factor (CNTF) is a potent survival factor for neurons and oligodendrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF and OSM. All of these four helix bundle cytokines share gp130 as a signal transducing subunit in their receptor complexes. CNTF, like FGF acidic, FGF basic, and PD-ECGF (platelet-derived endothelial cell growth factor), does not possess a signal sequence that would allow secretion of the factor by classical secretion pathways. The mechanism underlying the release of CNTF is unknown.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.
• AA Sequence: AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELT EAERLQENLQAYRTFHV LLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEK KLWGLKVLQELSQWT VRSIHDLRFISSHQTGIPARGSHYIANNKKM
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: CNTF ciliary neurotrophic factor [ Homo sapiens (human) ]
• Official Symbol: CNTF
• Synonyms: Ciliary Neurotrophic Factor; HCNTF
• Gene ID: 1270
• mRNA Refseq: NM_000614.4
• Protein Refseq: NP_000605.1
• MIM: 118945
• UniProt ID: P26441