Recombinant Human CNOT4 Protein, GST-tagged
Cat.No. : | CNOT4-1582H |
Product Overview : | Human CNOT4 full-length ORF (BAC11125.1, 1 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
Molecular Mass : | 88.1 kDa |
AA Sequence : | MQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVADNSSSIESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIITGIPASSGNSLDSLQDDNPPHWLKSLQALTEMDGPSAAPSQTHHSAPFSTQIPLHRASWNPYPPPSNPSSFHSPPPQIYYRVQHWTAIRQRGATIRKCRICPTLFSPSQPTTHSSLLISYVLKNPVPDQFFFSLTPDAMRSQGHYHLFINCKNFC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNOT4 CCR4-NOT transcription complex, subunit 4 [ Homo sapiens ] |
Official Symbol | CNOT4 |
Synonyms | CNOT4; CCR4-NOT transcription complex, subunit 4; NOT4; CCR4-NOT transcription complex subunit 4; CLONE243; NOT4H; CCR4-associated factor 4; E3 ubiquitin-protein ligase CNOT4; potential transcriptional repressor NOT4Hp; NOT4 (negative regulator of transcription 4, yeast) homolog; |
Gene ID | 4850 |
mRNA Refseq | NM_001008225 |
Protein Refseq | NP_001008226 |
MIM | 604911 |
UniProt ID | O95628 |
◆ Recombinant Proteins | ||
CNOT4-1938HF | Recombinant Full Length Human CNOT4 Protein, GST-tagged | +Inquiry |
Cnot4-2221M | Recombinant Mouse Cnot4 Protein, Myc/DDK-tagged | +Inquiry |
CNOT4-2039C | Recombinant Chicken CNOT4 | +Inquiry |
CNOT4-1582H | Recombinant Human CNOT4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT4-7401HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
CNOT4-7400HCL | Recombinant Human CNOT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT4 Products
Required fields are marked with *
My Review for All CNOT4 Products
Required fields are marked with *
0
Inquiry Basket