Recombinant Human CNOT3

Cat.No. : CNOT3-27807TH
Product Overview : Recombinant fragment of Human CCR4 NOT transcription complex subunit 3 with N terminal proprietary tag; Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : CCR4-NOT transcription complex subunit 3 is a protein that in humans is encoded by the CNOT3 gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
Sequence Similarities : Belongs to the CNOT2/3/5 family.
Gene Name CNOT3 CCR4-NOT transcription complex, subunit 3 [ Homo sapiens ]
Official Symbol CNOT3
Synonyms CNOT3; CCR4-NOT transcription complex, subunit 3; NOT3; CCR4-NOT transcription complex subunit 3; KIAA0691; LENG2; NOT3 (negative regulator of transcription 3; yeast) homolog; NOT3H;
Gene ID 4849
mRNA Refseq NM_014516
Protein Refseq NP_055331
MIM 604910
Uniprot ID O75175
Chromosome Location 19q13.4
Pathway Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CNOT3 Products

Required fields are marked with *

My Review for All CNOT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon