Recombinant Human CNOT3
Cat.No. : | CNOT3-27807TH |
Product Overview : | Recombinant fragment of Human CCR4 NOT transcription complex subunit 3 with N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | CCR4-NOT transcription complex subunit 3 is a protein that in humans is encoded by the CNOT3 gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT |
Sequence Similarities : | Belongs to the CNOT2/3/5 family. |
Gene Name | CNOT3 CCR4-NOT transcription complex, subunit 3 [ Homo sapiens ] |
Official Symbol | CNOT3 |
Synonyms | CNOT3; CCR4-NOT transcription complex, subunit 3; NOT3; CCR4-NOT transcription complex subunit 3; KIAA0691; LENG2; NOT3 (negative regulator of transcription 3; yeast) homolog; NOT3H; |
Gene ID | 4849 |
mRNA Refseq | NM_014516 |
Protein Refseq | NP_055331 |
MIM | 604910 |
Uniprot ID | O75175 |
Chromosome Location | 19q13.4 |
Pathway | Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
CNOT3-1780H | Recombinant Human CNOT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CNOT3-2135HFL | Recombinant Full Length Human CNOT3 Protein, C-Flag-tagged | +Inquiry |
CNOT3-630H | Recombinant Human CNOT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cnot3-2220M | Recombinant Mouse Cnot3 Protein, Myc/DDK-tagged | +Inquiry |
CNOT3-3666M | Recombinant Mouse CNOT3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT3-7402HCL | Recombinant Human CNOT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT3 Products
Required fields are marked with *
My Review for All CNOT3 Products
Required fields are marked with *
0
Inquiry Basket