Recombinant Human CNOT3

• Cat.No.: CNOT3-27807TH
• Product Overview: Recombinant fragment of Human CCR4 NOT transcription complex subunit 3 with N terminal proprietary tag; Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: CCR4-NOT transcription complex subunit 3 is a protein that in humans is encoded by the CNOT3 gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, lung and peripheral blood leukocytes.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKT
• Sequence Similarities: Belongs to the CNOT2/3/5 family.

Gene Information

• Gene Name: CNOT3 CCR4-NOT transcription complex, subunit 3 [ Homo sapiens ]
• Official Symbol: CNOT3
• Synonyms: CNOT3; CCR4-NOT transcription complex, subunit 3; NOT3; CCR4-NOT transcription complex subunit 3; KIAA0691; LENG2; NOT3 (negative regulator of transcription 3; yeast) homolog; NOT3H
• Gene ID: 4849
• mRNA Refseq: NM_014516
• Protein Refseq: NP_055331
• MIM: 604910
• Uniprot ID: O75175
• Chromosome Location: 19q13.4
• Pathway: Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem
• Function: protein binding