Recombinant Human CNOT2 protein, His-tagged
Cat.No. : | CNOT2-2465H |
Product Overview : | Recombinant Human CNOT2 protein(336-540 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 336-540 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QVLPDGRVTNIPQGMVTDQFGMIGLLTFIRAAETDPGMVHLALGSDLTTLGLNLNSPENLYPKFASPWASSPCRPQDIDFHVPSEYLTNIHIRDKLAAIKLGRYGEDLLFYLYYMNGGDVLQLLAAVELFNRDWRYHKEERVWITRAPGMEPTMKTNTYERGTYYFFDCLNWRKVAKEFHLEYDKLEERPHLPSTFNYNPAQQAF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CNOT2 CCR4-NOT transcription complex, subunit 2 [ Homo sapiens ] |
Official Symbol | CNOT2 |
Synonyms | CNOT2; CCR4-NOT transcription complex, subunit 2; NOT2; CCR4-NOT transcription complex subunit 2; CDC36; NOT2H; CCR4-associated factor 2; negative regulator of transcription 2; HSPC131; FLJ26456; |
Gene ID | 4848 |
mRNA Refseq | NM_001199302 |
Protein Refseq | NP_001186231 |
MIM | 604909 |
UniProt ID | Q9NZN8 |
◆ Recombinant Proteins | ||
CNOT2-3665M | Recombinant Mouse CNOT2 Protein | +Inquiry |
CNOT2-2036C | Recombinant Chicken CNOT2 | +Inquiry |
CNOT2-190H | Recombinant Human CNOT2 Protein, His-tagged | +Inquiry |
CNOT2-5613Z | Recombinant Zebrafish CNOT2 | +Inquiry |
CNOT2-938R | Recombinant Rhesus monkey CNOT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNOT2 Products
Required fields are marked with *
My Review for All CNOT2 Products
Required fields are marked with *
0
Inquiry Basket