Recombinant Human CNOT1 Protein, GST-tagged

Cat.No. : CNOT1-1576H
Product Overview : Human CNOT1 partial ORF ( NP_057368, 2278 a.a. - 2375 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CNOT1 (CCR4-NOT Transcription Complex Subunit 1) is a Protein Coding gene. Diseases associated with CNOT1 include Iritis. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include poly(A) RNA binding and protein domain specific binding.
Molecular Mass : 36.52 kDa
AA Sequence : NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNOT1 CCR4-NOT transcription complex, subunit 1 [ Homo sapiens ]
Official Symbol CNOT1
Synonyms CCR4-NOT transcription complex, subunit 1; CCR4-associated factor 1; NOT1; AD-005; CDC39; adrenal gland protein AD-005; NOT1H; CCR4-NOT transcription complex subunit 1; KIAA1007; NOT1 (negative regulator of transcription 1, yeast) homolog; Negative regulator of transcription subunit 1 homolog; hNOT1; CNOT1
Gene ID 23019
mRNA Refseq NM_016284.4
Protein Refseq NP_057368.3
MIM 604917
UniProt ID A5YKK6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CNOT1 Products

Required fields are marked with *

My Review for All CNOT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon