Recombinant Human CNOT1 Protein, GST-tagged

• Cat.No.: CNOT1-1576H
• Product Overview: Human CNOT1 partial ORF ( NP_057368, 2278 a.a. - 2375 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CNOT1 (CCR4-NOT Transcription Complex Subunit 1) is a Protein Coding gene. Diseases associated with CNOT1 include Iritis. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include poly(A) RNA binding and protein domain specific binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.52 kDa
• AA Sequence: NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNOT1 CCR4-NOT transcription complex, subunit 1 [ Homo sapiens ]
• Official Symbol: CNOT1
• Synonyms: CCR4-NOT transcription complex, subunit 1; CCR4-associated factor 1; NOT1; AD-005; CDC39; adrenal gland protein AD-005; NOT1H; CCR4-NOT transcription complex subunit 1; KIAA1007; NOT1 (negative regulator of transcription 1, yeast) homolog; Negative regulator of transcription subunit 1 homolog; hNOT1; CNOT1
• Gene ID: 23019
• mRNA Refseq: NM_016284.4
• Protein Refseq: NP_057368.3
• MIM: 604917
• UniProt ID: A5YKK6