Recombinant Human CNKSR2 Protein (650-800 aa), His-tagged

• Cat.No.: CNKSR2-1365H
• Product Overview: Recombinant Human CNKSR2 Protein (650-800 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 650-800 aa
• Description: May function as an adapter protein or regulator of Ras signaling pathways.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 19.1 kDa
• AA Sequence: AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CNKSR2 connector enhancer of kinase suppressor of Ras 2 [ Homo sapiens ]
• Official Symbol: CNKSR2
• Synonyms: CNKSR2; CNK2; KIAA0902; KSR2; MAGUIN
• Gene ID: 22866
• mRNA Refseq: NM_001168647
• Protein Refseq: NP_001162118
• MIM: 300724
• UniProt ID: Q8WXI2