Recombinant Human CNIH Protein, GST-tagged

• Cat.No.: CNIH-1559H
• Product Overview: Human CNIH full-length ORF ( NP_005767.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CNIH1 (Cornichon Family AMPA Receptor Auxiliary Protein 1) is a Protein Coding gene. Diseases associated with CNIH1 include Schizophrenia. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. An important paralog of this gene is CNIH3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.1 kDa
• AA Sequence: MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNIH cornichon homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: CNIH
• Synonyms: CNIH; cornichon homolog (Drosophila); protein cornichon homolog; CNIH1; CNIL; TGAM77; T-cell growth-associated molecule 77; MGC117156
• Gene ID: 10175
• mRNA Refseq: NM_005776
• Protein Refseq: NP_005767
• MIM: 611287
• UniProt ID: O95406