Recombinant Human CMTM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CMTM4-2824H
• Product Overview: CMTM4 MS Standard C13 and N15-labeled recombinant protein (NP_852662) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Molecular Mass: 22.7 kDa
• AA Sequence: MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLETAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CMTM4 CKLF-like MARVEL transmembrane domain containing 4 [ Homo sapiens (human) ]
• Official Symbol: CMTM4
• Synonyms: CMTM4; CKLF-like MARVEL transmembrane domain containing 4; chemokine like factor super family 4, chemokine like factor superfamily 4, CKLFSF4; CKLF-like MARVEL transmembrane domain-containing protein 4; chemokine-like factor super family 4; chemokine-like factor superfamily member 4; CKLFSF4
• Gene ID: 146223
• mRNA Refseq: NM_181521
• Protein Refseq: NP_852662
• MIM: 607887
• UniProt ID: Q8IZR5