Recombinant Human CMA1 Protein, GST-tagged

• Cat.No.: CMA1-1530H
• Product Overview: Human CMA1 full-length ORF (NP_001827.1, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and is thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Alternative splicing results in multiple variants. [provided by RefSeq, Apr 2015]
• Molecular Mass: 53.57 kDa
• AA Sequence: MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMA1 chymase 1, mast cell [ Homo sapiens ]
• Official Symbol: CMA1
• Synonyms: CMA1; chymase 1, mast cell; chymase; alpha-chymase; chymase, heart; chymase, mast cell; mast cell protease I; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; CYH; MCT1; MGC119890; MGC119891
• Gene ID: 1215
• mRNA Refseq: NM_001836
• Protein Refseq: NP_001827
• MIM: 118938
• UniProt ID: P23946